לגלישה באתר בגירסה המותאמת לסלולאר
| הוספת הודעה
הגדרות תצוגה

הגדרות עץ הודעות

מאפייני צפייה

הצג טקסט בתצוגה
הצג תגובות באופן
עדכן

פורום אבולוציה

המושג "אבולוציה" מחולק לשניים : עובדת האבולוציה, ותיאוריית האבולוציה המדעית. מבחינת "עובדת האבולוציה" : הכוונה היא לעובדה הנצפית כי התדירות של אללים (גרסאות שונות של אותו הגן) משתנה בקרב אוכלוסיה לאורך הדורות. שינוי גנטי זה בחומר התורשתי של הפרטים באוכלוסיה גורם לשינוי חיצוני (פנוטיפ) בקרב פרטיה, ולגיוון בתכונותיהם של הפרטים. עובדות אלו – בשילוב עם גוף ראיות עצום ממספר רב של תחומים מדעים, מובילים באופן בלתי נמנע אל המסקנה כי לכל המינים החיים על כדור-הארץ כיום, מחיידק ועד צמח ועד בני-האדם, הם בעלי צאצאים לאב קדמון אחד. תיאוריית האבולוציה, מצד שני, היא הכלי ההסברתי שמסביר את מנגנוני השינוי שבסופו של דבר גרמו להיווצרותם של כל היצורים החיים מיצורים פשוטים יותר. התיאוריה המקובל ביותר לכך היום היא תיאוריית הברירה הטבעית הניאו-דרוויניסטית. עיקרון הברירה הטבעית : כאשר ישנו מנגנון תורשה , שמאפשר גיוון - הדבר יוביל להצלחה רבייתית משתנה בקרב פרטיה. הברירה הטבעית מותירה יותר מהפרטים בעלי התכונות התורשתיות המאפשרות להם לשרוד ולהתרבות בצורה היעילה ביותר בסביבתם בהשוואה לאחרים. מדע האבולוציה מגדיר את המצליחים בתרחיש הנ"ל כבעלי כשירות גבוהה \ התאמה לסביבה ("פיטנס") המינים על פני כדור-הארץ, אם כן, על פי תיאוריית האבולוציה התפתחו כולם מאב קדמון אחד, והם ממשיכים לעבור אבולוציה עד היום. התיאוריה מסבירה באלגנטיות את הגיוון המדהים בעולם החי, ולמעשה שופכת אור על האחידות בעולם החי - למשל - מדוע לכל היצורים החיים אותו חומר התורשתי (הDNA)? מדוע ישנם מערכות מסוימות בגוף שאין להן שימוש \ מזיקות לבעליהן? מדוע ישנם מקטעים שלמים בDNA שאינם מבצעים דבר? מדוע ללוויתנים יש עצמות רגליים, אם הם חיות ימיות ונטולות רגליים? מדוע מדי פעם נולדים בני-אדם עם זנב או לוויתנים עם רגליים קדמיות? בין ביולוגים קיימת הסכמה רחבה בענין - אבולוציה היא לא עניין פעוט, היא אבן היסוד בביולוגיה המודרנית. לתיאוריית האבולוציה קיים ביסוס מחקרי רחב ממגוון תחומים במדע המודרני כגון : אמבריולוגיה השוואתית וביולוגיה התפתחותית, גנטיקה, מיקרוביולוגיה, אנטומיה\פיזיולוגיה השוואתית \ פליאנטולוגיה וגיאולוגיה \ אקולוגיה ועוד. הפורום יעסוק במגוון של נושאים, שהעיקרי בהם יהיה תיאוריית האבולוציה ונושאים מדעיים הסובבים אותה. כמו כן, יעסוק הפורום בסוגיית הכחשת מדע האבולוציה בפרט ומיני הכחשת מדע בכלל. וכמו שהביולוג האוקראני דובזהנסקי אמר: "שום דבר בביולוגיה לא הגיוני, חוץ מאשר באורה של האבולוציה"
 
תקנון הפורום:
1. אין להתבטא ולהעליב משתמשים בפורום - אין שום בעיה "להעליב" מישו שאינו משתתף בפורום אך יש להשתמש בשפה מכובדת בכל מקרה.
2. אין לנהל דיונים מנהלתיים על גבי הפורום. הצעות לשיפור, ביקורת ורעיונות יתקבלו בברכה אך במסרים פרטיים בלבד.
3. אסור לפתוח נושא בפורום שאינו בנושא האבולוציה או קשור לאבולוציה או ישירות לחברי הפורום הקבועים.
4. אם מעלים נושא שאינו קשור לאבולוציה יש להוסיף לכותרת סימן |א-ט| - מדובר רק בנושאים שרלוונטיים לחברי הפורום הקבועים אך אינם עוסקים באבולוציה (למשל ימי הולדת או חגים).
5. בריאתנות אינה מדע ולכן אינה רלוונטית לפורום.

אודות הפורום אבולוציה

המושג "אבולוציה" מחולק לשניים : עובדת האבולוציה, ותיאוריית האבולוציה המדעית. מבחינת "עובדת האבולוציה" : הכוונה היא לעובדה הנצפית כי התדירות של אללים (גרסאות שונות של אותו הגן) משתנה בקרב אוכלוסיה לאורך הדורות. שינוי גנטי זה בחומר התורשתי של הפרטים באוכלוסיה גורם לשינוי חיצוני (פנוטיפ) בקרב פרטיה, ולגיוון בתכונותיהם של הפרטים. עובדות אלו – בשילוב עם גוף ראיות עצום ממספר רב של תחומים מדעים, מובילים באופן בלתי נמנע אל המסקנה כי לכל המינים החיים על כדור-הארץ כיום, מחיידק ועד צמח ועד בני-האדם, הם בעלי צאצאים לאב קדמון אחד. תיאוריית האבולוציה, מצד שני, היא הכלי ההסברתי שמסביר את מנגנוני השינוי שבסופו של דבר גרמו להיווצרותם של כל היצורים החיים מיצורים פשוטים יותר. התיאוריה המקובל ביותר לכך היום היא תיאוריית הברירה הטבעית הניאו-דרוויניסטית. עיקרון הברירה הטבעית : כאשר ישנו מנגנון תורשה , שמאפשר גיוון - הדבר יוביל להצלחה רבייתית משתנה בקרב פרטיה. הברירה הטבעית מותירה יותר מהפרטים בעלי התכונות התורשתיות המאפשרות להם לשרוד ולהתרבות בצורה היעילה ביותר בסביבתם בהשוואה לאחרים. מדע האבולוציה מגדיר את המצליחים בתרחיש הנ"ל כבעלי כשירות גבוהה \ התאמה לסביבה ("פיטנס") המינים על פני כדור-הארץ, אם כן, על פי תיאוריית האבולוציה התפתחו כולם מאב קדמון אחד, והם ממשיכים לעבור אבולוציה עד היום. התיאוריה מסבירה באלגנטיות את הגיוון המדהים בעולם החי, ולמעשה שופכת אור על האחידות בעולם החי - למשל - מדוע לכל היצורים החיים אותו חומר התורשתי (הDNA)? מדוע ישנם מערכות מסוימות בגוף שאין להן שימוש \ מזיקות לבעליהן? מדוע ישנם מקטעים שלמים בDNA שאינם מבצעים דבר? מדוע ללוויתנים יש עצמות רגליים, אם הם חיות ימיות ונטולות רגליים? מדוע מדי פעם נולדים בני-אדם עם זנב או לוויתנים עם רגליים קדמיות? בין ביולוגים קיימת הסכמה רחבה בענין - אבולוציה היא לא עניין פעוט, היא אבן היסוד בביולוגיה המודרנית. לתיאוריית האבולוציה קיים ביסוס מחקרי רחב ממגוון תחומים במדע המודרני כגון : אמבריולוגיה השוואתית וביולוגיה התפתחותית, גנטיקה, מיקרוביולוגיה, אנטומיה\פיזיולוגיה השוואתית \ פליאנטולוגיה וגיאולוגיה \ אקולוגיה ועוד. הפורום יעסוק במגוון של נושאים, שהעיקרי בהם יהיה תיאוריית האבולוציה ונושאים מדעיים הסובבים אותה. כמו כן, יעסוק הפורום בסוגיית הכחשת מדע האבולוציה בפרט ומיני הכחשת מדע בכלל. וכמו שהביולוג האוקראני דובזהנסקי אמר: "שום דבר בביולוגיה לא הגיוני, חוץ מאשר באורה של האבולוציה"
 
תקנון הפורום:
1. אין להתבטא ולהעליב משתמשים בפורום - אין שום בעיה "להעליב" מישו שאינו משתתף בפורום אך יש להשתמש בשפה מכובדת בכל מקרה.
2. אין לנהל דיונים מנהלתיים על גבי הפורום. הצעות לשיפור, ביקורת ורעיונות יתקבלו בברכה אך במסרים פרטיים בלבד.
3. אסור לפתוח נושא בפורום שאינו בנושא האבולוציה או קשור לאבולוציה או ישירות לחברי הפורום הקבועים.
4. אם מעלים נושא שאינו קשור לאבולוציה יש להוסיף לכותרת סימן |א-ט| - מדובר רק בנושאים שרלוונטיים לחברי הפורום הקבועים אך אינם עוסקים באבולוציה (למשל ימי הולדת או חגים).
5. בריאתנות אינה מדע ולכן אינה רלוונטית לפורום.

סטטיסטיקה, והסתברות של חישובי אביוגנזה.

מאת: SilentMike  פורסם: 01/05/2006  עדכון אחרון: 01/07/2006  
 

שקרים, שקרים ארורים, סטטיסטיקה,

והסתברות של חישובי אביוגנזה.

(אביוגנזה = התפתחות חיים מדומם)

כתיבה: איאן מאוסגרייב (מקור).

תרגום מאנגלית: סיילנט מייק.

מונחון:

אציל transferase: אנזים או ריבוזום שמסנתז פפטידים.

ליגאז: אנזים או ריבוזום שמוסיף מונומר לפולימר, או מחבר שני פולימרים קצרים לפולימר ארוך יותר.

מונומר: כל תת-יחידה בודדת של פולימר. חומצת אמינו היא מונומר של פפטיד או חלבון, נוקלאוטיד (בסיס דנ"א. ס.מ.) הוא מונומר של אוליגונוקלאוטיד או פולינוקלאוטיד

נוקלאוטיד: אדנין, גואנין, ציטוזין ואוראציל. אלו הם המונומרים המרכיבים את האוליגונוקלאוטידים, והפולינוקלאוטידים כמו ה-RNA.

אוליגונוקלאוטיד: פולימר קצר של נוקלאוטידים.

Polymerase: אנזים או ריבוזום שמיצר פולימר ממונומרים. לדוגמא RNA Polymerase מיצר RNA מנוקלאוטידים בודדים.

ריבוזום: זרז ביולוגי העשוי מ-RNA.

משכפל עצמי: מולקולה המסוגלת ליצור עותק זהה או כמעט זהה של עצמה מיחידות קטנות יותר. יש לפחות ארבעה משכפלים עצמיים ידועים.

הקדמה

.

פעם בכמה זמן מישהו מעלה את ההצהרה "היווצרות של איזשהו אנזים במקרה עיוור הינה כמעט בלתי-אפשרית, ולכן אביוגנזה היא בלתי אפשרית". לעיתים קרובות הם מצטטים חישוב מרשים למראה של האסטרופיסיקאי פרד הויל, או שולפים משהו שנקרא "חוק בורל" כדי להוכיח שהחיים הם בלתי אפשריים סטטיסטית. האנשים האלה, כולל פרד, ביצעו את אחת או יותר מן השגיאות הבאות.

.

בעיות עם חישובי ה-"זה כה בלתי-סביר" של הבריאתנים.

.

1) הם מחשבים את ההסתברות ליצירה של חלבון "מודרני", או אפילו חידק שלם עם כל החלבונים ה-"מודרניים", ע"י מאורעות אקראיים. זו אינה תאורית האביוגנזה כלל.

.

2) הם מניחים שיש מספר קבוע של חלבונים, עם רצפי יחידות קבועים לכל חלבון, אשר נחוצים לחיים.

.

3) הם מחשבים את ההסתברות של נסיונות עוקבים, במקום נסיונות מקבילים.

.

4) הם לא מבינים את הכוונה בחישובי הסתברות.

.

5) הם ממעיטים מאוד בהערכת מספרם של האנזימים/ריבוזומים הפונקציונליים הקיימים בקבוצה של רצפי יחידות אקראיים.

.

אני אנסה לעבור על הטעויות האלה ולהראות למה אין זה אפשרי לבצע חישובי "הסתברות לאביוגנזה" באיזושהי דרך משמעותית.

.

כדורית פרוטופלאזמית קדמונית.

.

אז החישוב הולך שההסתברות ליצירת חלבון נתון באורך של 300 חומצות אמיניות (נניח אנזים כמו carboxypeptidase) באקראי היא (1/20) בחזקת 300 או סיכוי של 1 ל-2.04 כפול 10 בחזקת 390. בלתי סביר במידה מדהימה ובלתי-נתפסת. מספר זה מתוגבר אח"כ ע"י כך שלוקחים בחשבון את ההסתברות להיווצרות של כ-400 אנזימים נוספים עד שמגיעים למספר אשר הוא עד כדי כך גדול שרק החשיבה עליו גורמת למוחכם לטפטף החוצה מאוזניכם. זה נותן את הרושם שאפילו היווצרותו של האורגניזם הקטן ביותר נראית לחלוטין בלתי-אפשרית. אבל הנחה זו הינה לחלוטין בלתי נכונה.

.

ראשית, היווצרות של פולימרים ביולוגיים ממונומרים היא פונקציה של חוקי הכימיה והביוכימיה, ואלו באופן מובהק לא אקראיים.

.

שנית, כל ההנחה היא שגויה מלכתחילה, מפני שבתאורית האביוגנזה המודרנית "הדברים החיים" הראשונים יהיו פשוטים הרבה יותר, אפילו לא פרוטובקטריה או פרה-פרוטובקטריה (מה שאופרין קרה לו פרוטוביונט [8] ווסה קורא לו פרוגנוט [4]), אלא מולקולה פשוטה אחת או יותר, שכנראה מורכבת מלא יותר מ-30-40 תת-יחידות. מולקולות פשוטות אלו הן שהתפתחו בהדרגה למערכות משתפות פעולה יותר של שיכפול עצמי, ואז בסופו של דבר לאורגניזמים פשוטים [2, 5, 10, 15, 28]. אילוסטרציה המשווה פרוטוביונט היפותטי ובקטריה מודרנית מוצגת להלן.

 

.
ראשוני "הדברים החיים" יכולים היו להיות מולקולה יחידה בעלת יכולת שכפול עצמי, דומה לפפטיד המשכפל העצמי מקבוצת גאדירי [7, 17], או ההקסאנוקלאוטיד המשכפל העצמי [10], או אולי RNA polymerase אשר פועל על עצמו [12].

.
 
.
עוד השקפה לגבי המשכפלים העצמיים הראשונים היא קבוצות של זרזים –חלבונים, אנזימים או ריבוזומי
RNA– אשר שימרו את עצמם כמעגל קטליטי [3, 5, 15, 26, 28]. דוגמא אחת יכולה להיות המשכפל העצמי בעל שלוש היחידות של SunY [24]. מעגלים קטליטיים אלה יכלו להיות מוגבלים לבריכה טבעית  או לגונה קטנה, או להיות קומפלקס קטליטי המצטבר על חימר או על חומר שומני מעל חימר. בהינתן שיש רצפים קטליטיים רבים בקבוצה אקראית של פפטידים או פולינוקלאוטידים (ראה בהמשך) אין זה בלתי-סביר שקומפלקס קטליטי קטן יכול היה להיווצר.

.

שני מודלים אלו אינם סותרים זה את זה. פפטיד גאדירי יכול לעבור מוטציה וליצור מעגל קטליטי [9].

.

לא משנה אם המשכפלים העצמיים הראשונים היו מולקולות בודדות, או קומפלקסים של מולקולות קטנות, מודל זה אינו דומה כלל למודל "טורנדו במגרש גרוטאות יוצר מטוס 747" של הויל. רק כדי להבהיר את התמונה, הנה השוואה פשוטה בין התאוריה אותה מבקרים הבריאתנים, והתאוריה האמיתית של האביוגנזה.

.

. 

שימו לב שהתאוריה האמיתית מורכבת ממספר צעדים קטנים, ולמעשה השארתי כמה צעדים בחוץ (במיוחד בשלב שבין ההיפר-מעגל לפרוטוביונט) למען הפשטות. כל צעד מאופיין בעליה קלה בארגון ובמורכבות, וכימיקלים מטפסים אט-אט לקראת אורגניזמיות, במקום לעשות זאת בזינוק גדול יחיד [4, 10, 15, 28].

.

.

.

לא ברור מאיפה מגיע הרעיון הבריאתני לפיו אורגניזמים מודרניים נוצרים ספונטנית. הביטוי הנוסחאתי המודרני הראשון של האביוגנזה, היפותזת אופרין/הלדיין משנות ה-20, מתחיל עם חלבונים/פרוטאינואידים המתפתחים אט-אט לתאים אורגניים. אפילו הרעיונות שהסתובבו בשנות החמישים של המאה ה-19 לא היו תאוריות "ספונטניות". הכי מאוחר שאני מצליח להגיע אליו הוא הרעיון של למארק מ-1803! [8]

.

.

.

.

בהתחשב בכך שהבריאתנים מבקרים תאוריה בלי להתחשב בת יותר 150 שנים, ואשר אף ביולוג אבולוציוני לא מחזיק בה, למה להמשיך? מפני שיש כמה בעיות יסודיות בסטטיסטיקה ובביוכימיה אשר שבות ועולות ב-"הפרכות" שגויות אלה.

מיתוס "רצף החיים"

.

טענה נוספת שנשמעת לעיתים קרובות היא שיש "רצף חיים" של 400 חלבונים, ושאת רצפי חומצות האמינו בחלבונים אלה לא ניתן לשנות ולשמור את האורגניזמים האלה בחיים.

.

אבל זו שטות. טענת 400 החלבונים נראית כנובעת מקידוד החלבונים בגנום של החידק Mycobacterium genetalium, אשר לו יש את הגנום הקטן ביותר הידוע עבור אורגניזם מודרני כלשהו [20]. עם זאת, בדיקה של הגנום מגלה שניתן לצמצם חסם זה עוד יותר לסידור גנים מינימלי של 256 חלבונים [20]. שימו לב שוב שזהו אורגניזם מודרני. הפרוטוביונט/פרוגנוט הראשון היה כנראה קטן עוד יותר [4], ולו קדמו מערכות כימיות פשוטות יותר [3, 10, 11, 15].

.

באשר לטענה שהרצפים מהם בנויים החלבונים אינם ניתנים לשינוי, שוב מדובר בשטות. ישנם ברוב החלבונים אזורים בהם כמעט כל חומצת אמינו יכולה להיות מוחלפת בכל אחת אחרת, ואיזורים אחרים בהם חילופים שמרניים (בהם חומצות אמינו טעונות יכולות להיות מוחלפות בחומצות אמינו טעונות אחרות, נייטרליות בנייטרליות אחרות והידרופוביות בהידרופוביות אחרות) יכולים להתבצע. יש מולקולות שקולות פונקציונלית אשר בין 30% ל-50% מחומצות האמינו שלהן שונות. למעשה ניתן להחליף חלבונים לא זהים מבנית של חידקים בחלבונים של שמרים, וחלבונים של תולעים בחלבוני אדם, והאורגניזמים יחיו ללא בעיות מיוחדות.

.

"רצף החיים" הוא מיתוס.

.

הטלות מטבע למתחילים והרכבה מקרו-מולוקולרית.

אז בואו נשחק את המשחק הבריאתני ונביט על יצירת פפטיד בדרך של חיבור אקראי של חומצות אמינו. זו בהחלט אינה הדרך בה נוצרו פפטידים על כדור הארץ הקדום, אבל זו תהיה חוויה לימודית.

.

אני אשתמש כדוגמא בפפטיד "המשכפל העצמי" של קבוצת גאדירי שהוזכר לעיל [7]. הייתי יכול להשתמש בדוגמאות אחרות, כמו המשכפל העצמי ההקסאנוקלאוטיד [10], המשכפל העצמי של SunY [24] או ה- RNA polymeraseשתואר ע"י קבוצת אקלנד [12], אבל למען המשכיות היסטורית עם טענות בראיתניות קודמות פפטיד קטן הוא אידיאלי. פפטיד זה הוא באורך של 32 חומצות אמינו ברצף RMKQLEEKVYELLSKVACLEYEVARLKKVGE, ומהווה אנזים, פפטיד מסוג ליגאז אשר יוצר עותק של עצמו משתי תת-יחידות באורך של 16 חומצות אמינו. הוא גם בעל גודל והרכב אשר מותאמים אידיאלית להיווצר בסינתזת פפטידים אביוטית. העובדה שהוא משכפל עצמי היא תוספת אירונית.

.

ההסתברות להיווצרות המשכפל הנ"ל בסדרה של ניסיונות אקראיים עוקבים היא 1/20 בחזקת 32 או סיכוי של 1 4.29 כפול 10 בחזקת 40. זה הרבה, הרבה יותר סביר מ-1 ל-2.04 כפול עשר בחזקת 390 עבור התרחיש הבריאתני הסטנדרטי של "יצירת קרבוקסיפפטיד (carboxypeptidase) במקרה", אבל עדיין נראה נמוך באופן מגוחך.

.

עם זאת, יש צד נוסף לאומדני ההסתברות האלה, והוא נשען על העובדה שלרובנו אין חוש לסטטיסטיקה. כאשר מישהו אומר לנו שלמאורע מסוים יש סיכוי של אחד למליון להתרחש, רבים מאיתנו חושבים שמליון נסיונות צריכים להתבצע לפני שהמאורע הנ"ל קורה, אבל זה לא נכון.

.

הנה נסיון שאתם יכולים לבצע בעצמכם: קחו מטבע (למטבע שני צדדים שנקראים H ו-T), הטילו אותו מספר פעמים, כיתבו את התוצאות, ואז עשו זאת שוב. כמה פעמים תצטרכו לדעתכם לחזור על פרוצדורה (נסיון) זו לפני שתקבלו 4 תוצאות H ברצף?

.

עכשיו התוצאה של 4 תוצאות H ברצף היא 1/2 בחזקת 4 או סיכוי של 1 ל-16: האם עלינו לבצע 16 נסיונות (של 4 הטלות כל אחד. ס.מ.) כדי לקבל 4 תוצאות H (HHHH). לא, בניסויים עוקבים קיבלתי 11, 10, 6, 16, 1, 5 ו-3 נסיונות לפני ש-HHHH הופיע. המספר 1 ל-16 (או 1 למליון או 1 ל-10 בחזקת 40) נותן את הסבירות של מאורע בנסיון נתון, אבל לא אומר איפה הוא יתרחש בסדרה. אפשר להטיל HHHH בנסיון הראשון (לי זה קרה). אפילו בסיכוי של 1 ל-4.29 כפול 10 בחזקת 40, משכפל עצמי יכול היה להופיע בזמן מוקדם בצורה מפתיעה. אבל יש עוד.

.

סיכוי של 1 ל-4.29 כפול 10 בחזקת 40 הוא עדיין בלתי-סביר במידה מדהימה; קשה להתמודד עם המספר הזה. אפילו עם הטיעון שלעיל (תוכל לקבל את זה בנסיון הראשון) רוב האנשים יאמרו "לבטח עדיין יקח יותר זמן משכדור הארץ קיים ליצור את המשכפל הזה בשיטות אקראיות". לא ממש; בדוגמאות שלמעלה אנחנו בחנו נסיונות סדרתיים, כאילו יש רק משכפל חלבון/DNA אחד שמורכב בכל נסיון. למעשה היו מיליארדי נסיונות סימולטנים, כאשר מיליארדי מולקולות של אבני בנין מגיבות באוקינוסים, או באלפי הקילומטרים של קווי החוף שהיו יכולים לספק משטחים קטליטיים או שבלונות [2, 15].

.

בואו ונחזור לדוגמא עם המטבעות. נניח שלוקח דקה לזרוק את המטבע 4 פעמים; ליצר את HHHH יקח בממוצע 8 דקות. ועכשיו אם תקראו ל-16 חברים, כל אחד מחזיק מטבע, ותתנו לכל אחד להטיל את המטבע 4 פעמים סימולטנית; הזמן הממוצע ליצר את HHHH הוא עכשיו דקה 1. עכשיו נסו להשיג רצף של 6 תוצאות H ברצף; לזה יש הסתברות של 1/2 בחזקת 6 או 1 ל-64. זה יקח כחצי שעה בממוצע, אבל לכו וגייסו 64 אנשים, ותוכלו להשלים זאת בדקה. אם אתם רוצים רצף בסיכוי של 1 למיליארד, פשוט גייסו את אוכלוסית סין להטיל בעבורך מטבעות, ויהיה לכם את הרצף המבוקש מהר מאוד.

.

אז, אם על כדוה"א הפרהביוטי יש לנו מיליארד פפטידים שגדלים סימולטנית, זה מקטין את הזמן הדרוש ליצירת המשכפל שלנו משמעותית.

.

אוקי, אתם מסתכלים על המספר הזה שוב, סיכוי של 1 ל-4.29 כפול 10 בחזקת 40, זה מספר גדול, ולמרות שמיליארד מולקולות התחלתיות זה הרבה מולקולות, האם נוכל אי-פעם להשיג מספיק מולקולות להרכיב את המשכפל האקראי הראשון שלנו בפחות ממליארד שנים?

.

כן, קילוגרם אחד של חומצת האמינו ארגינין מכיל 2.85 כפול 10 בחזקת 24 מולקולות (זה הרבה יותר ממיליארד מיליארדים); טון של ארגינין מכיל 2.85 כפול 10 בחזקת 27 מולקולות. לו הייתם לוקחים סמי טריילר מלא מכל אחת מחומצות האמינו ומרוקנים אותם לאגם בגודל בינוני היו לכם מספיק מולקולות ליצר את המשכפל הספציפי שלנו בכמה עשרות שנים, בהינתן שניתן ליצר חלבון באורך של 55 חומצות אמינו בזמן של בין שבוע לשבועיים [14, 16].

.

אז איך זה מסתדר עם כדוה"א הפרהביוטי? בכדור הארץ המוקדם סביר למדי שלאוקינוס היה נפח של 1 כפול 10 בחזקת 24 ליטרים. בהינתן ריכוז חומצות אמינו של 1 כפול 10 בחזקת (6−) מולר (מרק דליל למדי, ראו צ`יבה וסגאן 1992 [23]), אז יש בערך 1 כפול 10 בחזקת 50 שרשראות התחלתיות פוטנציאליות, כך שמספר לא מבוטל של פפטידים מסוג ליגאז (בערך 1 כפול 10 בחזקת 31) יכולים היו להיות מיוצרים בזמן של פחות משנה, שלא לדבר על מיליון שנים. הסינתזה של משכפלים עצמיים פרמיטיביים יכולה להתרחש מהר יחסית, אפילו בהינתן סיכוי של 1 ל-4.29 כפול 10 בחזקת 40 (וזכרו, המשכפל שלנו יכול היה להיווצר עוד בניסיון הראשון).

.

הניחו שלוקח שבוע ליצר ליגאז [14,16]. במקרה זה הליגאז של גאדירי יכול היה להיות מיוצר בשבוע, וכל רצף של ציטוכרום C יכול היה להיות מיוצר בקצת יותר ממיליון שנים (ביחד עם חצי מכל רצפי הפפטידים האפשריים באורך 101, אשר שיעור גדול מהם מהווים חלבונים פונקציונליים מסוג כלשהו).

.

למרות שהשתמשתי בליגאז של גאדירי כדוגמא, כפי שציינתי לעיל אותם החישובים ניתנים לביצוע עבור המשכפל העצמי של SunY, או ה- RNA polymeraseשל אקלנד. אני משאיר זאת כתרגיל לקוראות, אבל המסקנה הכללית (אפשר לעשות המון מהדברים האלה בזמן קצר) היא זהה לאוליגונוקליאוטידים אלו.

.

מרחבי חיפוש, או כמה מחטים בערמת השחת?

אז הראתי שיצור מספר נתון של אנזימים אינו קשה בצורה מטמטמת מוח כפי שבריאתנים (ופרד הויל) טוענים. עוד אי-הבנה היא שרוב האנשים מאמינים שמספר האנזימים/הריבוזומים, ועל אחת כמה וכמה מספר ה- RNA polymerasesהריבוזומליים או כל צורה אחרת של משכפל עצמי, מיצגים תצורה מאוד לא סבירה, ושהסיכוי של אנזים/ריבוזום יחיד להיווצר מצירוף אקראי של חומצות אמינו/נוקליאוטידים -שלא לדבר על כמה מהם- הוא קטן מאוד.

.

אולם, ניתוח שביצע אקלנד מרמז שבמרחב רצפי ה-RNA באורך 220 נוקלאוטידים, מספר מדהים של 2.5 כפול 10 בחזקת 112 רצפים הם ליגאזים יעילים [12]. לא רע עבור חומר שנחשב קודם לכן לבעל תפקיד מבני בלבד. אם נחזור לאוקינוס הפרמיטיבי בן ה-1 כפול 10 בחזקת 24 ליטרים שלנו, ותחת הנחה של ריכוז נוקלאוטידים של 1 כפול 10 בחזקת (7−) מולר [23], אז יש בערך 1 כפול 10 בחזקת 49 שרשראות נוקלאוטידים פוטנציאליות, כך שמספר נכבד של ליגאזי RNA מועילים (בערך 1 כפול 10 בחזקת 34) יכלו להיות מיוצרים במשך שנה, שלא לדבר על מיליון שנים. המספר הפוטנציאלי של RNA polymerases הוא גבוה גם כן; בערך אחד מכל 10 בחזקת 20 רצפים הוא RNA polymerase [12]. שיקולים דומים תקפים גם לגבי אציל- transferases ריבוזומלים (בערך 1 מכל 10 בחזקת 15 רצפים), וסינתזה של נוקלאוטידים ריבוזומליים [1, 6, 13].

.

באופן דומה, מ-1 מכול 10 בחזקת 130 החלבונים באורך 100 יחידות, 3.8 כפול 10 בחזקת 61 הם של ציטוכרום C בלבד! [29] יש הרבה אנזימים פונקציונליים במרחב החיפוש של הנוקלאוטידים/פפטידים, כך שנראה סביר שאנסאמבל פונקציונלי של אנזימים יכול היה להתבשל במרק הפרהביוטי של כדור הארץ.

.

אז, אפילו עם מספרים ראליסטיים יותר (גם אם קצת מתישי מוח), הרכבה אקראית של חומצות אמינו לכדי "מערכות תומכות חיים" (בין אם אתם הולכים על היפר-מעגלים מבוססי אנזימים-חלבונים [10], מערכות של עולם RNA [18], או קו-אבולוציה של RNA וחלבונים [11, 25]) נראית בהחלט ברת השגה, אפילו בהינתן מספרים פסימיים עבור ריכוז המונומרים המקורי [23] וזמני הסינתזה.

.

מסקנות

.

ההנחה של חישובי ההסתברות של הבריאתנים הינה מופרכת מעיקרה, מפני שהיא מכוונת לתאוריה הלא נכונה. זאת ועוד, טיעון זה נתמך לעיתים קרובות בשגיאות וכשלים סטטיסטיים וביולוגיים.

.

נכון לעכשיו, מאחר ואין לנו מושג כמה סבירים הם החיים, למעשה בלתי אפשרי לקבוע הסתברויות בעלות משמעות לאלו מהצעדים אל החיים מלבד השניים הראשונים (מונומרים לפולימרים p=1, היווצרות של פולימרים קטליטיים p=1). עבור המעבר מפולימרים משכפלים להיפר-מעגל, ההסתברות עשויה גם כן להיות 1, אם קאופמן צודק בקשר לסגירות קטליטית והמודלים למעברי השלבים שלו, אבל זה דורש כימיה אמיתית ובדיקה במודלים מפורטים יותר בכדי לברר. עבור המעבר מהיפר-מעגל לפרוטוביונט, ההסתברות תלויה במושגים תיאורתיים שנמצאים עדיין בפיתוח, והיא אינה ידועה.

.

אולם בסופו של דבר סבירות החיים תלויה בכימיה ובביוכימיה שאנו עדיין לומדים, לא בהטלת מטבעות.

.

.

סימוכין:

 

[1] Unrau PJ, and Bartel DP, RNA-catalysed nucleotide synthesis. Nature, 395: 260-3, 1998

 

[2] Orgel LE, Polymerization on the rocks: theoretical introduction. Orig Life Evol Biosph, 28: 227-34, 1998

[3] Otsuka J and Nozawa Y. Self-reproducing system can behave as Maxwell`s demon: theoretical illustration under prebiotic conditions. J Theor Biol, 194, 205-221, 1998

[4] Woese C, The universal ancestor. Proc Natl Acad Sci USA , 95: 6854-6859.

[5] Varetto L, Studying artificial life with a molecular automaton. J Theor Biol, 193: 257-85, 1998

[6] Wiegand TW, Janssen RC, and Eaton BE, Selection of RNA amide synthases. Chem Biol, 4: 675-83, 1997

[7] Severin K, Lee DH, Kennan AJ, and Ghadiri MR, A synthetic peptide ligase. Nature, 389: 706-9, 1997

[8] Ruse M, The origin of life, philosophical perspectives. J Theor Biol, 187: 473-482, 1997

[9] Lee DH, Severin K, Yokobayashi Y, and Ghadiri MR, Emergence of symbiosis in peptide self-replication through a hypercyclic network. Nature, 390: 591-4, 1997

[10] Lee DH, Severin K, and Ghadri MR. Autocatalytic networks: the transition from molecular self-replication to molecular ecosystems. Curr Opinion Chem Biol, 1, 491-496, 1997

[11] Di Giulio M, On the RNA world: evidence in favor of an early ribonucleopeptide world. J Mol Evol, 45: 571-8, 1997

[12] Ekland EH, and Bartel DP, RNA-catalysed RNA polymerization using nucleoside triphosphates. Nature, 383: 192, 1996

[13] Lohse PA, and Szostak JW, Ribozyme-catalysed amino-acid transfer reactions. Nature, 381: 442-4, 1996

[14] Ferris JP, Hill AR Jr, Liu R, and Orgel LE, Synthesis of long prebiotic oligomers on mineral surfaces [see comments]. Nature, 381: 59-61, 1996

[15] Lazcano A, and Miller SL, The origin and early evolution of life: prebiotic chemistry, the pre- RNA world, and time. Cell, 85: 793-8, 1996

[16] Ertem G, and Ferris JP, Synthesis of RNA oligomers on heterogeneous templates. Nature, 379: 238-40, 1996

[17] Lee DH, Granja JR, Martinez JA, Severin K, and Ghadri MR, A self-replicating peptide. Nature, 382: 525-8, 1996

[18] Joyce GF, Building the RNA world. Ribozymes. Curr Biol, 6: 965-7, 1996

[19] Ishizaka M, Ohshima Y, and Tani T, Isolation of active ribozymes from an RNA pool of random sequences using an anchored substrate RNA. Biochem Biophys Res Commun, 214: 403-9, 1995

[20] Mushegian AR and Koonin, EV, A minimal gene set for cellular life derived by comparison of complete bacterial genomes. Proc. Natl. Acad. Sci. USA, 93: 10268-10273.

[21] Ekland EH, Szostak JW, and Bartel DP, Structurally complex and highly active RNA ligases derived from random RNA sequences. Science, 269: 364-70, 1995

[22] Breaker RR, and Joyce GF, Emergence of a replicating species from an in vitro RNA evolution reaction.Proc Natl Acad Sci U S A, 91: 6093-7, 1994

[23] Chyba C and Sagan C, Endogenous production, exogenous delivery and impact-shock synthesis of organic molecules: an inventory for the origins of life. Nature, 355: 125-32., 1992

[24] Doudna JA, Couture S, and Szostak JW, A multisubunit ribozyme that is a catalyst of and template for complementary strand RNA synthesis. Science, 251: 1605-8, 1991

[25] Lahav N, Prebiotic co-evolution of self-replication and translation or RNA world? J Theor Biol, 151: 531-9, 1991

[26] Stadler PF, Dynamics of autocatalytic reaction networks. IV: Inhomogeneous replicator networks. Biosystems, 26: 1-19, 1991

[27] Eigen M, Gardiner W, Schuster P, and Winkler-Oswatitsch R, The origin of genetic information. Sci Am, 244: 88-92, 96, et passim, 1981

[28] Eigen M, and Schuster P, The hypercycle. A principle of natural self-organization. Springer-Verlag, isbn 3-540-09293, 1979

[29] Yockey HP, On the information content of cytochrome c. J Theor Biol, 67: 345-76, 1977

ספרים מועילים:

Statistics at Square One, T.D.V. Swinscow, 8th Edition Paperback, Published by Amer   College of Physicians, 1983, ISBN: 0727901753

Evolution from Space, F Hoyle and Wickramasinghe, JM Dent and sons, London , 1981

Vital Dust: Life As a Cosmic Imperative, by Christian De Duve, Basic Books 1995, ISBN: 0465090451

The Major Transitions in Evolution, Maynard Smith J & Szathmary E, 1995, WH Freeman, ISBN: 0716745259

The Origins of Order: Self Organization and Selection in Evolution. By Stuart Kauffman, S. A. (1993) Oxford   University Press, NY, ISBN: 0195079515.

At Home in the Universe. By Stuart Kauffman, 1995) Oxford   University Press, NY.

לינקים (רשימת לינקים במאמר המקור ס.מ.)

תודות

.

תודה לג`ון ווילקינס ול- Jthomfordעל ההצעות המועילות והדיונים. תודה לג`ון גם בעבור כמה תמונות GIF ו-JPEG מגניבות.

  תגובה אחת
הטלת מטבע למתקדמים...  
ntzRufו | 31/10/2010 00:02:19

הודעות אחרונות

01:07 | 29.08.18 אורחים בפורום
19:16 | 24.02.18 אורחים בפורום
11:56 | 08.09.13 gfdhk
13:59 | 01.09.13 Caligola
08:02 | 01.09.13 Elaa56
10:04 | 31.08.13 GoghVV
20:57 | 30.08.13 רינהוהמשפחה1
10:56 | 25.08.13 gady18
16:17 | 21.08.13 Sophalin

חם בפורומים של תפוז

חפשו אותנו גם באינסטרגם
חפשו אותנו גם...
פודי תפוז - האינסטגרם החדש כל התמונות של...
חפשו אותנו גם באינסטרגם
חפשו אותנו גם...
פודי תפוז - האינסטגרם החדש כל התמונות של...
בפייסבוק שלנו כבר ביקרתם?
בפייסבוק שלנו כבר...
רוצים להיות תמיד מעודכנים במה שקורה בתפוז?
בפייסבוק שלנו כבר ביקרתם?
בפייסבוק שלנו כבר...
רוצים להיות תמיד מעודכנים במה שקורה בתפוז?

מקרא סימנים

בעלת תוכן
ללא תוכן
הודעה חדשה
הודעה נעוצה
אורח בפורום
הודעה ערוכה
מכיל תמונה
מכיל וידאו
מכיל קובץ